« Back
Home /
Recombinant Human Proliferation marker protein Ki-67(MKI67),partial

Recombinant Human Proliferation marker protein Ki-67(MKI67),partial

Manufacturer	Cusabio
Category	Oncology Neuroscience Neural Lineage Markers Neural Development Peptides & Proteins Recombinant Proteins By Organ Lung Cancer Bladder Cancer Breast Cancer Adhesion Molecule Markers
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP014597HU(A4)-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cell Cycle
Uniprot ID	P46013
Gene Names	MKI67
Organism	Homo sapiens (Human)
AA Sequence	RKLDAEDVIGSRRQPRAPKEKAQPLEDLASFQELS QTPGHTEELANGAADSFTSAPKQTPDSGKPLKISR RVLRAPKVEPVGDVVSTRDPVKSQSKSNTSLPPLP FKRGGGKDGSVTGTKRLRCMPAPEEIVEELPASKK QRVAPRARGKSSEPVVIMKRSLRTSAKRIEPAEEL NSNDMKTNKEEHKLQDSVPENKGISLRSRRQNKTE AEQQITEVFVLAERIEINRNEKKPMKTSPEMDIQN PDDGARKPIPRDKVTENKRCLRSARQNESSQPKVA EESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKT KSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNV CVKKIRTRSHRDSEDI
Expression Region	2891-3256aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	56.6 kDa
Relevance	Thought to be required for maintaining cell proliferation.
Reference	Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.Ahmad Y., Boisvert F.M., Lundberg E., Uhlen M., Lamond A.I.Mol. Cell. Proteomics 11:M111.013680.01-M111.013680.15(2012)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Required to maintain individual mitotic chromosomes dispersed in the cytoplasm following nuclear envelope disassembly
Subcellular Location	Chromosome, Nucleus, Nucleus, nucleolus
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time