Vergleich

Recombinant Human Nuclear receptor subfamily 1 group I member 2 (NR1I2)

ArtNr CSB-EP016048HU-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag Myc, SUMO, HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEV GGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMK RNARLRCPFRKGACEITRKTRRQCQACRLRKCLES GMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGV QGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLP GVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLK VSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMAD MST
Protein Familie Nuclear hormone receptor family, NR1 subfamily
Citations "The human orphan nuclear receptor PXR is activated by compounds that regulate CYP3A4 gene expression and cause drug interactions."
Lehmann J.M., McKee D.D., Watson M.A., Willson T.M., Moore J.T., Kliewer S.A.
J. Clin. Invest. 102:1016-1023(1998)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Orphan nuclear receptor PAR1,Orphan nuclear receptor PXR,Pregnane X receptor,Steroid and xenobiotic receptor
Lieferbar
Manufacturer - Targets
NR1I2
Manufacturer - Conjugate / Tag
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
69.8 kDa
General Research Areas
Signal Transduction
Relevance
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
Expression Region
1-434aa
Protein Length
Full Length
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes.
Subcellular Location
Nucleus
Tissue Specificity
Expressed in liver, colon and small intestine.
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen