« Zurück
Home /
Recombinant Human Programmed cell death protein 5(PDCD5)

Recombinant Human Programmed cell death protein 5(PDCD5)

Hersteller	Cusabio
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	500ug
Host	E.coli
ArtNr	CSB-EP017671HU-500
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Cell Biology
Uniprot ID	O14737
Gene Names	PDCD5
Organism	Homo sapiens (Human)
AA Sequence	MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHR EAEMRNSILAQVLDQSARARLSNLALVKPEKTKAV ENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEK TTTVKFNRRKVMDSDEDDDY
Expression Region	1-125aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	41.2 kDa
Alternative Name(s)	TF-1 cell apoptosis-related protein 19
Relevance	May function in the process of apoptosis.
Reference	"TFAR19, a novel apoptosis-related gene cloned from human leukemia cell line TF-1, could enhance apoptosis of some tumor cells induced by growth factor withdrawal." Liu H.T., Wang Y.G., Zhang Y.M., Song Q.S., Di C.H., Chen G., Tang J., Ma D.L. Biochem. Biophys. Res. Commun. 254:203-210(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function in the process of apoptosis.
Protein Families	PDCD5 family
Tissue Specificity	Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen