« Back
Home /
Recombinant Human Programmed cell death protein 5(PDCD5)

Recombinant Human Programmed cell death protein 5(PDCD5)

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	500ug
Host	E.coli
Item no.	CSB-EP017671HU-500
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Cell Biology
Uniprot ID	O14737
Gene Names	PDCD5
Organism	Homo sapiens (Human)
AA Sequence	MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHR EAEMRNSILAQVLDQSARARLSNLALVKPEKTKAV ENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEK TTTVKFNRRKVMDSDEDDDY
Expression Region	1-125aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	41.2 kDa
Alternative Name(s)	TF-1 cell apoptosis-related protein 19
Relevance	May function in the process of apoptosis.
Reference	"TFAR19, a novel apoptosis-related gene cloned from human leukemia cell line TF-1, could enhance apoptosis of some tumor cells induced by growth factor withdrawal." Liu H.T., Wang Y.G., Zhang Y.M., Song Q.S., Di C.H., Chen G., Tang J., Ma D.L. Biochem. Biophys. Res. Commun. 254:203-210(1999)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function in the process of apoptosis.
Protein Families	PDCD5 family
Tissue Specificity	Widely expressed. Highest levels in heart, testis, kidney, pituitary gland, adrenal gland and placenta.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 500ug

available

Request delivery time