Comparison

Recombinant Human Programmed cell death protein 5(PDCD5)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP017671HU-500
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
TF-1 cell apoptosis-related protein 19
AA Sequence
ADEELEALRRQRLAELQAKHGDPGDAAQQEAKHRE AEMRNSILAQVLDQSARARLSNLALVKPEKTKAVE NYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKT TTVKFNRRKVMDSDEDDDY
Research Topic
Cell Biology
Uniprot ID
O14737
Gene Names
PDCD5
Tag Info
N-terminal GST-tagged
Expression Region
1-125aa
MW of Fusion Proten
41, 2
Sequence Info
Full Length
Relevance
May function in the process of apoptosis.
Reference
"TFAR19, a novel apoptosis-related gene cloned from human leukemia cell line TF-1, could enhance apoptosis of some tumor cells induced by growth factor withdrawal."
Liu H.T., Wang Y.G., Zhang Y.M., Song Q.S., Di C.H., Chen G., Tang J., Ma D.L.
Biochem. Biophys. Res. Commun. 254:203-210(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 500ug
Available: In stock
Listprice: €880.00
Price: €880.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close