« Zurück
Startseite /
Recombinant Human Paraneoplastic antigen Ma1(PNMA1)

Recombinant Human Paraneoplastic antigen Ma1(PNMA1)

ArtNr	CSB-EP018266HUb9-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Heart & Blood Cancer Testicular & Prostate Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEI EETLQAAMPQVSYRMLGRMFWREENAKAALLELTG AVDYAAIPREMPGKGGVWKVLFKPPTSDAEFLERL HLFLAREGWTVQDVARVLGFQNPTPTPGPEMPAEM LNYILDNVIQPLVESIWYKRLTLFSGRDIPGPGEE TFDPWLEHTNEVLEEWQVSDVEKRRRLMESLRGPA ADVIRILKSNNPAITTAECLKALEQVFGSVESSRD AQI
Protein Familie	PNMA family
Citations	"Ma1, a novel neuron- and testis-specific protein, is recognized by the serum of patients with paraneoplastic neurological disorders." Dalmau J., Gultekin S.H., Voltz R., Hoard R., DesChamps T., Balmaceda C., Batchelor T., Gerstner E., Eichen J., Frennier J., Posner J.B., Rosenfeld M.R. Brain 122:27-39(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	37KDA neuronal protein; Neuron- and testis-specific protein 1
Lieferbar
Manufacturer - Targets	PNMA1
Manufacturer - Conjugate / Tag	N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	46.8 kDa
Relevance	Antibodies against PNMA1 are present in sera from patients suffering of paraneoplastic neurological disorders.
Expression Region	1-353aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location	Nucleus, nucleolus
Tissue Specificity	Testis- and brain-specific. In some cancer patients, specifically expressed by paraneoplastic tumor cells.
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP018266HUb9-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern