Vergleich

Recombinant Human Paraneoplastic antigen Ma1(PNMA1)

ArtNr CSB-EP018266HUb9-100
Hersteller Cusabio
Menge 100 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Format Liquid or Lyophilized powder
Specific against Human (Homo sapiens)
Host E.coli
Konjugat/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MAMTLLEDWCRGMDVNSQRALLVWGIPVNCDEAEI EETLQAAMPQVSYRMLGRMFWREENAKAALLELTG AVDYAAIPREMPGKGGVWKVLFKPPTSDAEFLERL HLFLAREGWTVQDVARVLGFQNPTPTPGPEMPAEM LNYILDNVIQPLVESIWYKRLTLFSGRDIPGPGEE TFDPWLEHTNEVLEEWQVSDVEKRRRLMESLRGPA ADVIRILKSNNPAITTAECLKALEQVFGSVESSRD AQI
Protein Familie PNMA family
Citations Ma1, a novel neuron- and testis-specific protein, is recognized by the serum of patients with paraneoplastic neurological disorders.
Dalmau J., Gultekin S.H., Voltz R., Hoard R., DesChamps T., Balmaceda C., Batchelor T., Gerstner E., Eichen J., Frennier J., Posner J.B., Rosenfeld M.R.
Brain 122:27-39(1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 37KDA neuronal protein; Neuron- and testis-specific protein 1
Lieferbar
Manufacturer - Targets
PNMA1
Manufacturer - Conjugate / Tag
N-terminal 10xHis-B2M-JD-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
46.8 kDa
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Relevance
Antibodies against PNMA1 are present in sera from patients suffering of paraneoplastic neurological disorders.
Biologically Active
Not Test
Expression Region
1-353aa
Protein Length
Full Length
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location
Nucleus, nucleolus
Tissue Specificity
Testis- and brain-specific. In some cancer patients, specifically expressed by paraneoplastic tumor cells.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 02.10.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen