« Zurück
Home /
Recombinant Human Protein phosphatase 1A(PPM1A)

Recombinant Human Protein phosphatase 1A(PPM1A)

Hersteller	Cusabio
Kategorie	Oncology Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Targets for Rodent Neurosciences By Organ Colorectal Cancer Neurodegeneration Markers;Products Peptides & Proteins Recombinant Proteins general
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	1mg
Host	E.coli
ArtNr	CSB-EP018489HU-1
Konjugat/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Areas	Signal Transduction
Uniprot ID	P35813
Gene Names	PPM1A
Organism	Homo sapiens (Human)
AA Sequence	GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEM EDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYC CEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFL EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYF INCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQ NAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPT EQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMG NEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSR DNMSVILICFPNAPKVSPEAVKKEAELDKYLECRV EEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGEL ASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW
Expression Region	1-382aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	69.3 kDa
Alternative Name(s)	Protein phosphatase 2C isoform alpha
Relevance	Enzyme with a broad specificity. Negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling. Dephosphorylates PRKAA1 and PRKAA2. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.
Reference	Protein phosphatase 2Calpha inhibits the human stress-responsive p38 and JNK MAPK pathways. Takekawa M., Maeda T., Saito H. EMBO J. 17:4744-4752(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Form	Liquid or Lyophilized powder
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Enzyme with a broad specificity. Negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling. Dephosphorylates PRKAA1 and PRKAA2. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.
Subcellular Location	Nucleus, Cytoplasm, cytosol, Membrane, Lipid-anchor
Protein Families	PP2C family
Paythway	MAPKsignalingpathway
Tag Information	N-terminal GST-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP018489HU-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1mg

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen