Comparison

Recombinant Human Protein phosphatase 1A(PPM1A)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP018489HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Protein phosphatase 2C isoform alpha
AA Sequence
GAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEM EDAHTAVIGLPSGLESWSFFAVYDGHAGSQVAKYC CEHLLDHITNNQDFKGSAGAPSVENVKNGIRTGFL EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYF INCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQ NAGGSVMIQRVNGSLAVSRALGDFDYKCVHGKGPT EQLVSPEPEVHDIERSEEDDQFIILACDGIWDVMG NEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSR DNMSVILICFPNAPKVSPEAVKKEAELDKYLECRV EEIIKKQGEGVPDLVHVMRTLASENIPSLPPGGEL ASKRNVIEAVYNRLNPYKNDDTDSTSTDDMW
Research Topic
Signal Transduction
Uniprot ID
P35813
Gene Names
PPM1A
Tag Info
N-terminal GST-tagged
Expression Region
1-382aa
MW of Fusion Proten
69, 3
Sequence Info
Full Length
Relevance
Enzyme with a broad specificity. Negatively regulates TGF-beta signaling through dephosphorylating SMAD2 and SMAD3, resulting in their dissociation from SMAD4, nuclear export of the SMADs and termination of the TGF-beta-mediated signaling. Dephosphorylates PRKAA1 and PRKAA2. Plays an important role in the termination of TNF-alpha-mediated NF-kappa-B activation through dephosphorylating and inactivating IKBKB/IKKB.
Reference
"Protein phosphatase 2Calpha inhibits the human stress-responsive p38 and JNK MAPK pathways."
Takekawa M., Maeda T., Saito H.
EMBO J. 17:4744-4752(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close