« Zurück
Startseite /
Recombinant Mouse 60S acidic ribosomal protein P0(Rplp0)

Recombinant Mouse 60S acidic ribosomal protein P0(Rplp0)

ArtNr	CSB-EP020336MO-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNV GSKQMQQIRMSLRGKAVVLMGKNTMMRKAIRGHLE NNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLAN KVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQA LGITTKISRGTIEILSDVQLIKTGDKVGASEATLL NMLNISPFSFGLIIQQVFDNGSIYNPEVLDITEQA LHSRFLEGVRNVASVCLQIGYPTVASVPHSIINGY KRV
Protein Familie	Universal ribosomal protein uL10 family
Citations	"The mouse homologue of the human acidic ribosomal phosphoprotein PO: a highly conserved polypeptide that is under translational control." Krowczynska A.M., Coutts M., Makrides S., Brawerman G.Nucleic Acids Res. 17:6408-6408(1989)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	60S ribosomal protein L10E
Lieferbar
Manufacturer - Targets	Rplp0
Manufacturer - Conjugate / Tag	N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	54.2 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
Expression Region	1-317aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ribosomal protein P0 is the functional equivalent of E.coli protein L10.
Subcellular Location	Nucleus, Cytoplasm
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP020336MO-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 18.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern