« Zurück
Startseite /
Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial

Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial

ArtNr	CSB-EP301307HUS-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 200 ug 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KVNAKIDRLNQIASGLGVVGQAAGFPLKRHDKVDD LSKVGLSRNQELAQKIDNLNQAVSEAKAGFFGNLE QTIDKLKDSTKHNPMNLWVESAKKVPASLSAKLDN YATNSHIRINSNIKNGAINEKATGMLTQKNPEWLK LVNDKIVAHNVGSVPLSEYDKIGFNQKNMKDYSDS FKFSTKLNNAVKDTNSGFTQFLTNAFSTASYYCLA RENAEHGIKNVNTKGGFQKS
Citations	"Molecular characterization of the 128-kDa immunodominant antigen of Helicobacter pylori associated with cytotoxicity and duodenal ulcer." Covacci A., Censini S., Bugnoli M., Petracca R., Burroni D., Macchia G., Massone A., Papini E., Xiang Z., Figura N., Rappuoli R.Proc. Natl. Acad. Sci. U.S.A. 90:5791-5795(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	120 kDa protein
Lieferbar
Manufacturer - Targets	cagA
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	41.3 kDa
General Research Areas	Microbiology
Relevance	May be necessary for the transcription, folding, export, or function of the cytotoxin.
Expression Region	918-1147aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be necessary for the transcription, folding, export, or function of the cytotoxin.
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP301307HUS-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 09.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern