« Zurück
Startseite /
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4(ITIH4),partial

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4(ITIH4),partial

ArtNr	CSB-EP617923HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Konjugat/Tag	SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTT QTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVN LLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVW VHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMT MDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRD TDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLR VQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Protein Familie	ITIH family
Citations	"BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4." Kroczynska B., King-Simmons L., Alloza L., Alava M.A., Elguindi E.C., Blond S.Y. Biochem. Biophys. Res. Commun. 338:1467-1477(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Inter-alpha-trypsin inhibitor family heavy chain-related protein
Lieferbar
Manufacturer - Targets	ITIH4
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	42.9 kDa
Relevance	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Expression Region	689-930aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Subcellular Location	Secreted
Tissue Specificity	Liver specific.
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP617923HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern