« Back
Home /
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4(ITIH4),partial

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4(ITIH4),partial

Item no.	CSB-EP617923HU-500
Manufacturer	Cusabio
Amount	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	E.coli
Conjugate/Tag	SUMO, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTT QTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVN LLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVW VHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMT MDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRD TDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLR VQGNDHSATRERRLDYQEGPPGVEISCWSVEL
Protein Family	ITIH family
Citations	"BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4." Kroczynska B., King-Simmons L., Alloza L., Alava M.A., Elguindi E.C., Blond S.Y. Biochem. Biophys. Res. Commun. 338:1467-1477(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Inter-alpha-trypsin inhibitor family heavy chain-related protein
Available
Manufacturer - Targets	ITIH4
Manufacturer - Conjugate / Tag	N-terminal 6xHis-SUMO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	42.9 kDa
Relevance	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Expression Region	689-930aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.
Subcellular Location	Secreted
Tissue Specificity	Liver specific.
Biologically active	Not Test
Protein length	Partial

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP617923HU-500-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 500 ug

available

Delivery expected until 9/25/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer