« Zurück
Startseite /
Recombinant Mouse Serine protease inhibitor Kazal-type 2(Spink2)

Recombinant Mouse Serine protease inhibitor Kazal-type 2(Spink2)

ArtNr	CSB-EP806409MO-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLN PVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC
Citations	"Novel miRNA cluster generated by extensive alternate splicing of a multicopy non-coding RNA from mouse Y-heterochromatin." Bhattacharya R., Dhople V.M., Jesudasan R.A. Submitted (JUN-2009)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Targets	Spink2
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	15.0 kDa
General Research Areas	Cell Biology
Relevance	Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis.
Expression Region	17-86aa
Protein Length	Full Length of Mature Protein
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis.
Subcellular Location	Secreted
Tissue Specificity	Expressed in sperm (at protein level). Expressed in testis but not in ovary, brain, heart, kidney or lung. Within testis, expressed in epididymis and germ cells.
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP806409MO-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern