Comparison

Recombinant Mouse Serine protease inhibitor Kazal-type 2(Spink2)

Item no. CSB-EP806409MO-500
Manufacturer Cusabio
Amount 500 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Conjugate/Tag Myc, HIS
Purity Greater than 85% as determined by SDS-PAGE.
Sequence HETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLN PVCGTDMNTYSNECTLCMKIREDGSHINIIKDEPC
Citations "Novel miRNA cluster generated by extensive alternate splicing of a multicopy non-coding RNA from mouse Y-heterochromatin."
Bhattacharya R., Dhople V.M., Jesudasan R.A.
Submitted (JUN-2009)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Manufacturer - Targets
Spink2
Manufacturer - Conjugate / Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
15.0 kDa
General Research Areas
Cell Biology
Relevance
Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis.
Expression Region
17-86aa
Protein Length
Full Length of Mature Protein
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Inhibits trypsin in a dose-dependent manner. Required for maintenance of normal spermatogenesis. May be involved in regulating serine protease-dependent germ cell apoptosis.
Subcellular Location
Secreted
Tissue Specificity
Expressed in sperm (at protein level). Expressed in testis but not in ovary, brain, heart, kidney or lung. Within testis, expressed in epididymis and germ cells.
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close