« Zurück
Startseite /
Recombinant Hesperocyparis arizonica Pectate lyase 1

Recombinant Hesperocyparis arizonica Pectate lyase 1

ArtNr	CSB-EP871029COADd1-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	Myc, GST, HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	ADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPG TLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKT IDGRGAVVHLGNGGPCLFMRKASHVILHGLHIHGC NTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNA WIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHH KVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMP RARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGN SFT
Protein Familie	Polysaccharide lyase 1 family, Amb a subfamily
Citations	"Molecular cloning of major allergen from Cupressus arizonica pollen: Cup a 1."Aceituno E., Del Pozo V., Minguez A., Arrieta I., Cortegano I., Cardaba B., Gallardo S., Rojo M., Palomino P., Lahoz C.Clin. Exp. Allergy 30:1750-1758(2000)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Major pollen allergen Cup a 1; Allergen: Cup a 1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	65.1 kDa
General Research Areas	Allergen
Relevance	Has pectate lyase activity.
Expression Region	22-367aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Has pectate lyase activity.
Sequence Info	Full Length of Mature Protein
Organism	Cupressus arizonica (Arizona cypress) (Callitropsis arizonica)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP871029COADd1-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern