Vergleich

Recombinant Human Mitochondrial ornithine transporter 1(SLC25A15)

ArtNr CSB-EP897578HU-10
Hersteller Cusabio
Menge 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag GST
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKV KMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPA LIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLS DLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEM ETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSS TLLREVPGYFFFFGGYELSRSFFASGRSKDELGPV PLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGK QAG
Protein Familie Mitochondrial carrier (TC 2.A.29) family
Citations "Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is caused by mutations in a gene encoding a mitochondrial ornithine transporter."
Camacho J.A., Obie C., Biery B., Goodman B.K., Hu A., Almashanu S., Steel G., Casey R., Lombard M., Mitchell G.A., Valle D.
Nat. Genet. 22:151-158(1999)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Solute carrier family 25 member 15
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal GST-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
59.7 kDa
Buffer
Tris-based buffer, 50% glycerol
Relevance
Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.
Expression Region
1-301aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.
Subcellular Location
Mitochondrion inner membrane, Multi-pass membrane protein
Tissue Specificity
Highly expressed in liver, pancreas, testis, lung and small intestine. Lower levels are detected in spleen, kidney, brain and heart.
Involvement in disease
Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome (HHH syndrome)
Gene Names
SLC25A15
Sequence Info
Full Length
Organism
Homo sapiens (Human)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen