« Zurück
Startseite /
Recombinant Human Mitochondrial ornithine transporter 1(SLC25A15)

Recombinant Human Mitochondrial ornithine transporter 1(SLC25A15)

ArtNr	CSB-EP897578HU-500
Hersteller	Cusabio
Menge	500 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKV KMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPA LIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLS DLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEM ETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSS TLLREVPGYFFFFGGYELSRSFFASGRSKDELGPV PLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGK QAG
Protein Familie	Mitochondrial carrier (TC 2.A.29) family
Citations	"Hyperornithinaemia-hyperammonaemia-homocitrullinuria syndrome is caused by mutations in a gene encoding a mitochondrial ornithine transporter." Camacho J.A., Obie C., Biery B., Goodman B.K., Hu A., Almashanu S., Steel G., Casey R., Lombard M., Mitchell G.A., Valle D. Nat. Genet. 22:151-158(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Solute carrier family 25 member 15
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	59.7 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.
Expression Region	1-301aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Ornithine transport across inner mitochondrial membrane, from the cytoplasm to the matrix.
Subcellular Location	Mitochondrion inner membrane, Multi-pass membrane protein
Tissue Specificity	Highly expressed in liver, pancreas, testis, lung and small intestine. Lower levels are detected in spleen, kidney, brain and heart.
Involvement in disease	Hyperornithinemia-hyperammonemia-homocitrullinuria syndrome (HHH syndrome)
Gene Names	SLC25A15
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-EP897578HU-500-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 500 ug

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern