« Zurück
Startseite /
Recombinant Human Lactoperoxidase(LPO)

Recombinant Human Lactoperoxidase(LPO)

ArtNr	CSB-MP013066HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	TRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLT SLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRRK PALGAANRALARWLPAEYEDGLSLPFGWTPGKTRN GFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQW GQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDN CFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYK SLAREQINALTSFLDASFVYSSEPSLASRLRNLSS PLG
Protein Familie	Peroxidase family, XPO subfamily
Citations	"The cytotoxic activity of lactoperoxidase: enhancement and inhibition by neuroactive compounds." Everse J., Coates P.W. Free Radic. Biol. Med. 37:839-849(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Salivary peroxidase,SPO,SAPX
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	76.6 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Antimicrobial agent which utilizes hydrogen peroxide and thiocyanate (SCN) to generate the antimicrobial substance hypothiocyanous acid (HOSCN). May contribute to airway host defense against infection.
Expression Region	81-712aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Antimicrobial agent which utilizes hydrogen peroxide and thiocyanate (SCN) to generate the antimicrobial substance hypothiocyanous acid (HOSCN) (By similarity). May contribute to airway host defense against infection.
Subcellular Location	Secreted
Tissue Specificity	Mammary gland; milk and salivary gland. Found in bronchial submucosal glands.
Gene Names	LPO
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP013066HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern