« Back
Home /
Recombinant Human Lactoperoxidase(LPO)

Recombinant Human Lactoperoxidase(LPO)

Item no.	CSB-MP013066HU-50
Manufacturer	Cusabio
Amount	50 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Conjugate/Tag	Myc, HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	TRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLT SLSLEVGCGAPAPVVRCDPCSPYRTITGDCNNRRK PALGAANRALARWLPAEYEDGLSLPFGWTPGKTRN GFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQW GQIVDHDLDFAPDTELGSSEYSKAQCDEYCIQGDN CFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYK SLAREQINALTSFLDASFVYSSEPSLASRLRNLSS PLG
Protein Family	Peroxidase family, XPO subfamily
Citations	"The cytotoxic activity of lactoperoxidase: enhancement and inhibition by neuroactive compounds." Everse J., Coates P.W. Free Radic. Biol. Med. 37:839-849(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Salivary peroxidase,SPO,SAPX
Available
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	76.6 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	Antimicrobial agent which utilizes hydrogen peroxide and thiocyanate (SCN) to generate the antimicrobial substance hypothiocyanous acid (HOSCN). May contribute to airway host defense against infection.
Expression Region	81-712aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Antimicrobial agent which utilizes hydrogen peroxide and thiocyanate (SCN) to generate the antimicrobial substance hypothiocyanous acid (HOSCN) (By similarity). May contribute to airway host defense against infection.
Subcellular Location	Secreted
Tissue Specificity	Mammary gland; milk and salivary gland. Found in bronchial submucosal glands.
Gene Names	LPO
Sequence Info	Full Length of Mature Protein
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-MP013066HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50 ug

available

Delivery expected until 11/13/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer