« Zurück
Startseite /
Recombinant Human Blood group Rh(D) polypeptide(RHD),partial

Recombinant Human Blood group Rh(D) polypeptide(RHD),partial

ArtNr	CSB-MP019677HU-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	GST
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Protein Familie	Ammonium transporter (TC 2.A.49) family, Rh subfamily
Citations	Rh(D) antigen expression and isolation of a new Rh(D) cDNA isoform in human erythroleukemic K562 cells. Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RHXIII,Rh polypeptide 2,RhPII,Rhesus D antigen,CD_antigen: CD240D
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.6 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Cardiovascular
Relevance	May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Expression Region	388-417aa
Protein Length	Partial
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Subcellular Location	Membrane, Multi-pass membrane protein
Tissue Specificity	Restricted to tissues or cell lines expressing erythroid characters.
Gene Names	RHD
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP019677HU-100-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern