« Zurück
Startseite /
Recombinant Human Blood group Rh(D) polypeptide(RHD),partial

Recombinant Human Blood group Rh(D) polypeptide(RHD),partial

ArtNr	CSB-MP019677HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug 500 ug
Kategorie	Oncology Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	GST
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Protein Familie	Ammonium transporter (TC 2.A.49) family, Rh subfamily
Citations	"Rh(D) antigen expression and isolation of a new Rh(D) cDNA isoform in human erythroleukemic K562 cells." Suyama K., Lunn R., Haller S., Goldstein J. Blood 84:1975-1981(1994)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RHXIII,Rh polypeptide 2,RhPII,Rhesus D antigen,CD_antigen: CD240D
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	29.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Cardiovascular
Relevance	May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Expression Region	388-417aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be part of an oligomeric complex which is likely to have a transport or channel function in the erythrocyte membrane.
Subcellular Location	Membrane, Multi-pass membrane protein
Tissue Specificity	Restricted to tissues or cell lines expressing erythroid characters.
Gene Names	RHD
Sequence Info	Partial
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP019677HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern