« Zurück
Startseite /
Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial(Dlat)

Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial(Dlat)

ArtNr	CSB-MP804374MOe1-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISE GDLIAEVETDKATVGFESLEECYMAKILVPEGTRD VPVGSIICITVEKPQDIEAFKNYTLDLAAAAAPQA APAAAPAPAAAPAAPSASAPGSSYPTHMQIVLPAL SPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKAT IGFEVQEEGYLAKILVPEGTRDVPLGAPLCIIVEK QEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPP TPQ
Citations	"Molecular cloning, and characterization and expression of dihydrolipoamide acetyltransferase component of murine pyruvate dehydrogenase complex in bile duct cancer cells." Wang L., Kaneko S., Kagaya M., Ohno H., Honda M., Kobayashi K. J. Gastroenterol. 37:449-454(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex,Pyruvate dehydrogenase complex component E2
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Conjugate / Tag	NO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	58.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Signal Transduction
Relevance	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2, and thereby links the glycolytic pathway to the tricarboxylic cycle.
Expression Region	86-642aa
Protein Length	Full Length of Mature Protein
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	Dlat
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 20.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern