« Back
Home /
Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial(Dlat)

Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial(Dlat)

Item no.	CSB-MP804374MOe1-100
Manufacturer	Cusabio
Amount	100 ug
Quantity options	10 ug 100 ug 20 ug 50 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISE GDLIAEVETDKATVGFESLEECYMAKILVPEGTRD VPVGSIICITVEKPQDIEAFKNYTLDLAAAAAPQA APAAAPAPAAAPAAPSASAPGSSYPTHMQIVLPAL SPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKAT IGFEVQEEGYLAKILVPEGTRDVPLGAPLCIIVEK QEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPP TPQ
Citations	"Molecular cloning, and characterization and expression of dihydrolipoamide acetyltransferase component of murine pyruvate dehydrogenase complex in bile duct cancer cells." Wang L., Kaneko S., Kagaya M., Ohno H., Honda M., Kobayashi K. J. Gastroenterol. 37:449-454(2002)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex,Pyruvate dehydrogenase complex component E2
Available
Manufacturer - Type	Protein
Manufacturer - Conjugate / Tag	NO-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	58.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Signal Transduction
Relevance	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2, and thereby links the glycolytic pathway to the tricarboxylic cycle.
Expression Region	86-642aa
Protein Length	Full Length of Mature Protein
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	Dlat
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Manufacturer - Format	Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100 ug

available

Delivery expected until 11/20/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer