« Zurück
Startseite /
Recombinant Human Zinc finger protein GLI2(GLI2),partial

Recombinant Human Zinc finger protein GLI2(GLI2),partial

ArtNr	CSB-YP009500HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTK EYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQ KPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSR LENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRA KHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVK TVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTE PGGPESTEASSTSQAVEDCL
Protein Familie	GLI C2H2-type zinc-finger protein family
Citations	"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GLI family zinc finger protein 2; Tax helper protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	28.5 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856).
Expression Region	412-641aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Functions as transcription regulator in the hedgehog (Hh) pathway
Subcellular Location	Nucleus, Cytoplasm, Cell projection, cilium
Tissue Specificity	Expressed in breast cancers (at protein level) (PubMed:26565916). Isoform 1 and isoform 4 are expressed in HTLV-1-infected T-cell lines (at protein level) (PubMed:9557682). Isoform 1 and isoform 2 are strongly expressed in HTLV-1-infected T-cell lines (PubMed:9557682). Isoform 3 and isoform 4 are weakly expressed in HTLV-1-infected T-cell lines (PubMed:9557682).
Involvement in disease	Holoprosencephaly 9 (HPE9); Culler-Jones syndrome (CJS)
Paythway	Hedgehogsignalingpathway
Gene Names	GLI2
Sequence Info	Partial
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP009500HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern