Vergleich

Recombinant Bovine coronavirus Spike glycoprotein(S),partial

ArtNr CSB-YP333052BJO-100
Hersteller Cusabio
Menge 100 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host Yeast
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNM SSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKF AIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLY YNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPV GVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNG PGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCT PDPIT
Protein Familie Betacoronaviruses spike protein family
Citations Comparison of the nucleotide and deduced amino acid sequences of the S genes specified by virulent and avirulent strains of bovine coronaviruses.Zhang X., Kousoulas K.G., Storz J.Virology 183:397-404(1991)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias E2;Peplomer protein
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
25.7 kDa
Relevance
S1 attaches the virion to the cell mbrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection.S2 is a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell mbrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell mbranes .
Expression Region
326-540aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
S1 attaches the virion to the cell membrane by binding to 9-O-acetylated sialic acid containing proteins, initiating the infection.
Subcellular Location
Spike protein S2: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type I membrane protein, Note=Accumulates in the endoplasmic reticulum-Golgi intermediate compartment, where it participates in virus particle assembly, Some S oligomers may be transported to the plasma membrane, where they may mediate cell-cell fusion (By similarity), SUBCELLULAR LOCATION: Spike protein S1: Virion membrane, Peripheral membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Peripheral membrane protein
Gene Names
S
Sequence Info
Partial
Organism
Bovine coronavirus (strain vaccine) (BCoV) (BCV)
Storage Buffer
Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

 
Schließen