« Zurück
Startseite /
Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial

Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial

ArtNr	CSB-YP347068HUS-1
Hersteller	Cusabio
Menge	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KNFNNNNNNGLKNGGEPIYAQVNKKKTGQVASPEE PIYAQVAKKVTKKIDQLNQAATSGFGGVGQAGFPL KRHDKVEDLSKVGRSVSPEPIYATIDDLGGSFPLK RHDKVDDLSKVGLSRNQELTQKIDNLSQAVSEAKA GFFGNLEQTIDKLKDFTKNNPVNLWAESAKKVPAS LSAKLDNYATNSHTRINSNIQNGAINEKATGTERQ KNPEWLKLVNDKIVAHNVGSVPLSEYDNIGFSQKN MKD
Citations	Cloning and expression of a high-molecular-mass major antigen of Helicobacter pylori evidence of linkage to cytotoxin production.Tummuru M.K.R., Cover T.L., Blaser M.J.Infect. Immun. 61:1799-1809(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	120KDA protein
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	35.5 kDa
Relevance	May be necessary for the transcription, folding, export, or function of the cytotoxin.
Expression Region	877-1182aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be necessary for the transcription, folding, export, or function of the cytotoxin.
Gene Names	cagA
Sequence Info	Partial
Organism	Helicobacter pylori (Campylobacter pylori)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP347068HUS-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 23.10.2025