« Back
Home /
Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial

Recombinant Helicobacter pylori Cytotoxicity-associated immunodominant antigen(cagA),partial

Item no.	CSB-YP347068HUS-1
Manufacturer	Cusabio
Amount	1 mg
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Conjugate/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	KNFNNNNNNGLKNGGEPIYAQVNKKKTGQVASPEE PIYAQVAKKVTKKIDQLNQAATSGFGGVGQAGFPL KRHDKVEDLSKVGRSVSPEPIYATIDDLGGSFPLK RHDKVDDLSKVGLSRNQELTQKIDNLSQAVSEAKA GFFGNLEQTIDKLKDFTKNNPVNLWAESAKKVPAS LSAKLDNYATNSHTRINSNIQNGAINEKATGTERQ KNPEWLKLVNDKIVAHNVGSVPLSEYDNIGFSQKN MKD
Citations	Cloning and expression of a high-molecular-mass major antigen of Helicobacter pylori evidence of linkage to cytotoxin production.Tummuru M.K.R., Cover T.L., Blaser M.J.Infect. Immun. 61:1799-1809(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	120KDA protein
Available
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	35.5 kDa
Relevance	May be necessary for the transcription, folding, export, or function of the cytotoxin.
Expression Region	877-1182aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May be necessary for the transcription, folding, export, or function of the cytotoxin.
Gene Names	cagA
Sequence Info	Partial
Organism	Helicobacter pylori (Campylobacter pylori)
Storage Buffer	Tris-based buffer, 50% glycerol

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-YP347068HUS-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 10/23/2025

Compare

Add to wishlist

Get an offer

Request delivery time