« Zurück
Startseite /
Parathyroid Hormone (PTH) (1-34), bovine

Parathyroid Hormone (PTH) (1-34), bovine

ArtNr	RP10364-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Peptides & Proteins Peptides By Organ Thyroid Cancer
Typ	Peptides
Specific against	Cattle (Bovine)
Purity	> 95%
Sequence	AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF ; {ALA}{VAL}{SER}{GLU}{ILE}{GLN}{PHE}{MET}{HIS}{ASN}{LEU}{GLY}{LYS}{HIS}{LEU}{SER}{SER}{MET}{GLU}{ARG}{VAL}{GLU}{TRP}{LEU}{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}{VAL}{HIS}{ASN}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10364-Parathyroid_Hormone_PTH_1-34_bovine, Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone is secreted as a linear protein of 84 amino acids. Parathyroid hormone accomplishes its job by stimulating at least three processes: Mobilization of calcium from bone, Enhancing absorption of calcium from the small intestine, Suppression of calcium loss in urine.</td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store ai -20C. Keep tightly colsed. Store in a cool dry place. </td></tr>
Similar products	Parathyroid
Lieferbar
Country of Origin	USA
Storage Conditions	Store ai -20C. Keep tightly colsed. Store in a cool dry place.
Description	Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone is secreted as a linear protein of 84 amino acids. Parathyroid hormone accomplishes its job by stimulating at least three processes: Mobilization of calcium from bone, Enhancing absorption of calcium from the small intestine, Suppression of calcium loss in urine.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern