« Back
Home /
Parathyroid Hormone (PTH) (1-34), bovine

Parathyroid Hormone (PTH) (1-34), bovine

Item no.	RP10364-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Peptides & Proteins Peptides By Organ Thyroid Cancer
Type	Peptides
Specific against	Cattle (Bovine)
Purity	> 95%
Sequence	AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF ; {ALA}{VAL}{SER}{GLU}{ILE}{GLN}{PHE}{MET}{HIS}{ASN}{LEU}{GLY}{LYS}{HIS}{LEU}{SER}{SER}{MET}{GLU}{ARG}{VAL}{GLU}{TRP}{LEU}{ARG}{LYS}{LYS}{LEU}{GLN}{ASP}{VAL}{HIS}{ASN}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10364-Parathyroid_Hormone_PTH_1-34_bovine, Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone is secreted as a linear protein of 84 amino acids. Parathyroid hormone accomplishes its job by stimulating at least three processes: Mobilization of calcium from bone, Enhancing absorption of calcium from the small intestine, Suppression of calcium loss in urine.</td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store ai -20C. Keep tightly colsed. Store in a cool dry place. </td></tr>
Similar products	Parathyroid
Available
Country of Origin	USA
Storage Conditions	Store ai -20C. Keep tightly colsed. Store in a cool dry place.
Description	Parathyroid hormone is the most important endocrine regulator of calcium and phosphorus concentration in extracellular fluid. This hormone is secreted from cells of the parathyroid glands and finds its major target cells in bone and kidney. Parathyroid hormone is secreted as a linear protein of 84 amino acids. Parathyroid hormone accomplishes its job by stimulating at least three processes: Mobilization of calcium from bone, Enhancing absorption of calcium from the small intestine, Suppression of calcium loss in urine.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer