PACAP 38, frog

ArtNr	RP10339-0.5
Hersteller	GenScript
Menge	0.5 mg
Quantity options	0.5 mg 5.0 mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2 ; {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{ILE}{LYS}{ASN}{LYS}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10339-PACAP_38, PACAP 38 is a neuropeptide that has substantial sequence homology to vasoactive intestinal peptide (VIP). Both VIP and PACAP 38 are equipotent at the VCAP-2 receptor, while PACAP 38 is equipotent to PACAP-27 and more potent than VIP at the PAC-1 receptor. Pituitary adenylate cyclase activating polypeptide (PACAP) 38 stimulates the release of LH from superfused pituitary cells and that the hypothalamus and anterior pituitary have highly selective binding sites for the peptide. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	PACAP
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	PACAP 38 is a neuropeptide that has substantial sequence homology to vasoactive intestinal peptide (VIP). Both VIP and PACAP 38 are equipotent at the VCAP-2 receptor, while PACAP 38 is equipotent to PACAP-27 and more potent than VIP at the PAC-1 receptor. Pituitary adenylate cyclase activating polypeptide (PACAP) 38 stimulates the release of LH from superfused pituitary cells and that the hypothalamus and anterior pituitary have highly selective binding sites for the peptide.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern