« Back
Home /
PACAP 38, frog

PACAP 38, frog

Item no.	RP10339-0.5
Manufacturer	GenScript
Amount	0.5 mg
Quantity options	0.5 mg 5.0 mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRIKNK-NH2 ; {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{ILE}{LYS}{ASN}{LYS}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10339-PACAP_38, PACAP 38 is a neuropeptide that has substantial sequence homology to vasoactive intestinal peptide (VIP). Both VIP and PACAP 38 are equipotent at the VCAP-2 receptor, while PACAP 38 is equipotent to PACAP-27 and more potent than VIP at the PAC-1 receptor. Pituitary adenylate cyclase activating polypeptide (PACAP) 38 stimulates the release of LH from superfused pituitary cells and that the hypothalamus and anterior pituitary have highly selective binding sites for the peptide. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	PACAP
Available
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	PACAP 38 is a neuropeptide that has substantial sequence homology to vasoactive intestinal peptide (VIP). Both VIP and PACAP 38 are equipotent at the VCAP-2 receptor, while PACAP 38 is equipotent to PACAP-27 and more potent than VIP at the PAC-1 receptor. Pituitary adenylate cyclase activating polypeptide (PACAP) 38 stimulates the release of LH from superfused pituitary cells and that the hypothalamus and anterior pituitary have highly selective binding sites for the peptide.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer