Vergleich

beta-Amyloid (1-40) Europäischer Partner

ArtNr RP20528-0.5
Hersteller GenScript
Menge 0.5 mg
Quantity options 0.5 mg 1.0 mg
Kategorie
Typ Peptides
Specific against other
Purity > 95%
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ; {ASP}{ALA}{GLU}{PHE}{ARG}{HIS}{ASP}{SER}{GLY}{TYR}{GLU}{VAL}{HIS}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP} {VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP20528_0_5-_Amyloid_1_40_, Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region. </td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water, may be dissolved in any buffer of pH >9. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr><tr><th>Notes</th><td colspan="7"> This product is a chemically-modified beta-amyloid (1-40) precursor, which belongs to GenScript’s "click peptides".The "click peptides" are best described by the following key features: 1. Enhanced Stability—The O-acyl moiety within the click peptide is stable even under acidic pH. 2. Convenient and quick process—The "click peptides" can be easily converted to native peptide at pH 7.4 or above. 3. No by-product formation in the conversion process. 4. High Solubility in water compared to the native peptide. 5. Superior quality—After the "click", the aggregative property of the peptides is significantly minimized compared to its native format. </td></tr>
Similar products beta-Amyloid
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C
Description
Beta-amyloid peptide (beta-APP) is a 40-residue peptide implicated in the pathogenesis of Alzheimer’s disease (AD) and aged Down's Syndrome, which is promoted by the acquisition of an additional copy of chromosome 21. The peptide is a proteolytic product of the much larger amyloid precursor protein (APP) encoded by a gene on chromosome 21. The peptide comprises a large extracellular N-terminal domain and a short hydrophobic membrane-spanning domain, followed by a short C-terminal region. Beta-APP both precedes and forms part of the transmembrane region.
Solubility
Insoluble in water, may be dissolved in any buffer of pH >9.
Notes
This product is a chemically-modified beta-amyloid (1-40) precursor, which belongs to GenScript’s "click peptides".The "click peptides" are best described by the following key features: 1. Enhanced Stability—The O-acyl moiety within the click peptide is stable even under acidic pH. 2. Convenient and quick process—The "click peptides" can be easily converted to native peptide at pH 7.4 or above. 3. No by-product formation in the conversion process. 4. High Solubility in water compared to the native peptide. 5. Superior quality—After the "click", the aggregative property of the peptides is significantly minimized compared to its native format.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen