beta-Amyloid (1-40), rat

Hersteller GenScript
Kategorie
Typ Peptides
Specific against Rat
Menge 0.5mg
ArtNr RP10016-0.5
eClass 6.1 34160400
eClass 9.0 32160409
Lieferbar
Sequence (one-letter code)
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (three-letter code)
{ASP}{ALA}{GLU}{PHE}{GLY}{HIS}{ASP}{SER}{GLY}{PHE}{GLU}{VAL}{ARG}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
Description
The effect of beta-amyloid-(1-40) was investigated on long-term potentiation of glutamatergic excitatory postsynaptic field potentials recorded in the inner molecular layer in the rat dentate gyrus in vitro. In the presence of 200 nM beta-amyloid-(1-40) there was an increase in long-term potentiation of 51%. Basal synaptic transmission was not affected. These results provide direct evidence that a relatively low concentration of beta-amyloid-(1-40) increases synaptic plasticity.
Purity
> 95%
Storage
Store at -20C.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt und Sicherheitsdatenblatt) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Menge: 0.5mg
Lieferbar: In stock
Listenpreis: 167,80 €
Preis: 167,80 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen