beta-Amyloid (1-40), rat

Hersteller GenScript
Kategorie
Typ Peptides
Specific against Rat
Menge 1.0mg
ArtNr RP10016-1
eClass 6.1 34160400
eClass 9.0 32160409
Lieferbar
Sequence (one-letter code)
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence (three-letter code)
{ASP}{ALA}{GLU}{PHE}{GLY}{HIS}{ASP}{SER}{GLY}{PHE}{GLU}{VAL}{ARG}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}
Description
The effect of beta-amyloid-(1-40) was investigated on long-term potentiation of glutamatergic excitatory postsynaptic field potentials recorded in the inner molecular layer in the rat dentate gyrus in vitro. In the presence of 200 nM beta-amyloid-(1-40) there was an increase in long-term potentiation of 51%. Basal synaptic transmission was not affected. These results provide direct evidence that a relatively low concentration of beta-amyloid-(1-40) increases synaptic plasticity.
Purity
> 95%
Storage
Store at -20C.
Menge: 1.0mg
Lieferbar: Out of stock
nicht lieferbar

fragen Sie nach einem alternativen Produkt

Fragen zum Produkt?
 
Schließen