Vergleich

PACAP (1-38), human, ovine, rat Europäischer Partner

ArtNr RP10335-0.5
Hersteller GenScript
Menge 0.5 mg
Quantity options 0.5 mg 5 mg
Kategorie
Typ Peptides
Specific against Rat (Rattus norvegicus)
Purity > 95%
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 ; {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10335-PACAP_1-38,PACAP (1-38),a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP),gastrin releasing peptide (GRP),and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently.</td></tr><tr><th>Solubility</th><td colspan="7">The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7">> 95% </td></tr><tr><th>Storage</th><td colspan="7">Store the peptide at -20C. </td></tr><tr><th>Notes</th><td colspan="7">PACAP stimulates adenylate cyclase in rat anterior pituitary cells.</td></tr>
Similar products PACAP
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Peptide/Catalog Peptides/Catalog Peptides
Country of Origin
USA
Shipping Temperature
25°C
Storage Conditions
-20°C
Product Line
Amyloid Peptides
Description
PACAP (1-38), a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP), gastrin releasing peptide (GRP), and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently.
Solubility
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal
NH2
Notes
PACAP stimulates adenylate cyclase in rat anterior pituitary cells.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen