Comparison

PACAP (1-38), human, ovine, rat European Partner

Item no. RP10335-0.5
Manufacturer GenScript
Amount 0.5 mg
Quantity options 0.5 mg 5 mg
Category
Type Peptides
Specific against Rat (Rattus norvegicus)
Purity > 95%
Sequence HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 ; {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10335-PACAP_1-38,PACAP (1-38),a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP),gastrin releasing peptide (GRP),and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently.</td></tr><tr><th>Solubility</th><td colspan="7">The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7">> 95% </td></tr><tr><th>Storage</th><td colspan="7">Store the peptide at -20C. </td></tr><tr><th>Notes</th><td colspan="7">PACAP stimulates adenylate cyclase in rat anterior pituitary cells.</td></tr>
Similar products PACAP
Shipping Condition Room temperature
Available
Manufacturer - Category
Peptide/Catalog Peptides/Catalog Peptides
Country of Origin
USA
Shipping Temperature
25°C
Storage Conditions
-20°C
Product Line
Amyloid Peptides
Description
PACAP (1-38), a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP), gastrin releasing peptide (GRP), and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently.
Solubility
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal
NH2
Notes
PACAP stimulates adenylate cyclase in rat anterior pituitary cells.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close