« Zurück
Startseite /
Corticotropin Releasing Factor, human, rat

Corticotropin Releasing Factor, human, rat

ArtNr	RP10982-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Typ	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 ; {SER}{GLU}{GLU}{PRO}{PRO}{ILE}{SER}{LEU}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{GLU}{VAL}{LEU}{GLU}{MET}{ALA}{ARG}{ALA}{GLU}{GLN}{LEU}{ALA}{GLN}{GLN}{ALA}{HIS}{SER}{ASN}{ARG}{LYS}{LEU}{MET}{GLU}{ILE}{ILE}-N
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10982-Corticotropin_Releasing_Factor_CRF_Corticotropin-releasing hormone_CRH_human_rat, Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine, autonomic, behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water (1 mg/ml), clear and colorless </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr>
Similar products	Corticotropin
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C
Description	Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine, autonomic, behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.
Solubility	Soluble in water (1 mg/ml), clear and colorless
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.