« Back
Home /
Corticotropin Releasing Factor, human, rat

Corticotropin Releasing Factor, human, rat

Item no.	RP10982-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Specific against	Rat (Rattus norvegicus)
Purity	> 95%
Sequence	SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 ; {SER}{GLU}{GLU}{PRO}{PRO}{ILE}{SER}{LEU}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{GLU}{VAL}{LEU}{GLU}{MET}{ALA}{ARG}{ALA}{GLU}{GLN}{LEU}{ALA}{GLN}{GLN}{ALA}{HIS}{SER}{ASN}{ARG}{LYS}{LEU}{MET}{GLU}{ILE}{ILE}-N
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10982-Corticotropin_Releasing_Factor_CRF_Corticotropin-releasing hormone_CRH_human_rat, Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine, autonomic, behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water (1 mg/ml), clear and colorless </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr>
Similar products	Corticotropin
Available
Country of Origin	USA
Storage Conditions	Store at -20C
Description	Corticotropin-releasing factor (CRF) has been widely implicated as playing a major role in modulating the endocrine, autonomic, behavioral and immune responses to stress. Corticotropin Releasing Factor (CRF) is a hypothalamic peptide that releases adrenocorticotropic hormone (ACTH) and endorphin from the anterior pituitary. Corticotropin Releasing Factor (CRF) is also a neurotransmitter in the central nervous system, and is involved in autonomic and endocrine responses to stress.
Solubility	Soluble in water (1 mg/ml), clear and colorless
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.