NOGGIN, Human

Hersteller GenScript
Kategorie
Typ Proteins
Specific against Human
Menge 20ug 
ArtNr Z02753-20
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Product Line
Cytokine, Chemokines & Growth Factors
Description
Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-ß family and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2, -7, -13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis.
M.W.
Approximately 46.2 kDa non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.
Purity
>95% by SDS-PAGE and HPLC analyses.
Endotoxin Level
Less than 0.2EU/ug of rHu NOGGIN as determined by LAL method.
Specific Activity
Fully biologically active when compared to standard. The ED50 determined by inhibiting BMP-4-induced alkaline phosphatase production ofmurine ATDC5 cells is less than 80 ng/ml, corresponding to a specific activity of >1.3x104 IU/mg in the presence of 5ng/ml BMP-4.
Storage
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Formulation
Lyophilized from a 0.2µ, m filtered concentrated, solution in 30% acetonitrile, 0.1% TFA.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in, 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at, <-20°, C. Further dilutions should be made in appropriate buffered solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Sequence
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCG WIPIQYPIIS ECKCSC
Menge: 20ug 
Lieferbar: In stock
Listenpreis: 227,73 €
Preis: 227,73 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen