Vergleich

MCP-4/CCL13, Human Europäischer Partner

ArtNr Z02836-1
Hersteller GenScript
Menge 1 mg
Quantity options 1 mg 20 ug
Kategorie
Typ Proteins
Format Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against Human (Homo sapiens)
Purity >96% by SDS-PAGE and HPLC analyses.
Sequence QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02836-MCP-4_CCL13_Human, CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.</td></tr><tr><th>M.W.</th><td colspan="7"> 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >96% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuMCP-4/CCL13 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human monocytes is less than 100 ng/ml, corresponding to a specific activity of &
Similar products MCP-4/CCL13
Lieferbar
Specificity Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human monocytes is less than 100 ng/ml, corresponding to a specific activity of >, 1.0 x 104 IU/mg.
Country of Origin
USA
Storage Conditions
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight
8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
Product Line
Cytokine, Chemokines & Growth Factors
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human monocytes is less than 100 ng/ml, corresponding to a specific activity of >, 1.0 x 104 IU/mg.
Description
CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2µ, m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Endotoxin Level
Less than 0.2EU/ug of rHuMCP-4/CCL13 as determined by LAL method.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen