« Back
Home /
MCP-4/CCL13, Human

MCP-4/CCL13, Human

Item no.	Z02836-1
Manufacturer	GenScript
Amount	1 mg
Quantity options	1 mg 20 ug
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Aging & Neurological Disorders By Cell Type Carcinoma Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cardiovascular Research Atherosclerosis Cell Migration & Invasion
Type	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	Human (Homo sapiens)
Purity	>96% by SDS-PAGE and HPLC analyses.
Sequence	QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02836-MCP-4_CCL13_Human, CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.</td></tr><tr><th>M.W.</th><td colspan="7"> 8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >96% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rHuMCP-4/CCL13 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human monocytes is less than 100 ng/ml, corresponding to a specific activity of &
Similar products	MCP-4/CCL13
Available
Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human monocytes is less than 100 ng/ml, corresponding to a specific activity of ＞, 1.0 x 104 IU/mg.
Country of Origin	USA
Storage Conditions	This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight	8.6 kDa, a single non-glycosylated polypeptide chain containing 75 amino acids.
Product Line	Cytokine, Chemokines & Growth Factors
Manufacturer - Specificity	Fully biologically active when compared to standard. The ED50 determined by a chemotaxis bioassay using human monocytes is less than 100 ng/ml, corresponding to a specific activity of ＞, 1.0 x 104 IU/mg.
Description	CCL13 is a chemoattractant for monocytes and eosinophils, and activates basophils. In addition, it has been reported to be chemotactic for CD4+ and CD8+ T cells, with an activity almost equivalent to that of MCP-3. The bioactivities of CCL13 is most likely mediated by the CC chemokine receptors CCR-2 and CCR-3, both of which have been shown to bind CCL13.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 °, C. Further dilutions should be made in appropriate buffered solutions.
Formulation	Lyophilized from a 0.2µ, m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Endotoxin Level	Less than 0.2EU/ug of rHuMCP-4/CCL13 as determined by LAL method.
Usage	This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Z02836-1-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 1 mg

available

Delivery expected until 9/25/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer