Tumor Necrosis Factor-alpha ( TNF-alpha), Mouse

Hersteller GenScript
Kategorie
Typ Proteins
Specific against Mouse
Menge 20ug 
ArtNr Z02774-20
eClass 6.1 34160400
eClass 9.0 42020190
Lieferbar
Product Line
Cytokine, Chemokines & Growth Factors
Description
Tumor necrosis factor alpha (TNF-alpha) is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. Mouse TNF-alpha occurs as a membrane-anchored form. The naturally-occurring form of TNF-alpha is glycosylated, but non-glycosylated recombinant TNF-alpha has comparable biological activity. The biologically active native form of TNF-alpha is reportedly a trimer. Human and mouse TNF-alpha show approximately 79% homology at the amino acid level and crossreactivity between the two species.
M.W.
Approximately 17.3 kDa. The recombinant mouse TNF-alpha is a soluble 157 amino acid protein which corresponds to C-terminal extracellular domain of the full length transmembrane protein.
Purity
>97% by SDS-PAGE and HPLC analyses.
Endotoxin Level
Less than 0.2EU/ug of rMuTNF-alpha as determined by LAL method.
Specific Activity
Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is, 1.0x107 units/mg.
Storage
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Formulation
Lyophilized from a 0.2um filtered solution in PBS, pH 7.2.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage
This material is for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Sequence
MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVY SQVLFKGQGC PDYVLLTHTV SRFAISYQEKVNLLSAVKSP CPKDTPEGAE LKPWYEPIYL GGVFQLEKGD QLSAEVNLPK YLDFAESGQV YFGVIAL
Menge: 20ug 
Lieferbar: In stock
Listenpreis: 227,73 €
Preis: 227,73 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?
 
Schließen