« Zurück
Startseite /
Interleukin-1 beta (IL-1beta), RhesusMacaque

Interleukin-1 beta (IL-1beta), RhesusMacaque

ArtNr	Z02758-1
Hersteller	GenScript
Menge	1 mg
Quantity options	1 mg 10 ug
Kategorie	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Cholesterol & Lipid Metabolism By Cell Type Hematology Leukemia Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion Cell Culture Cytokines Cytoskeleton Cell Stainings ECM Intermediate filaments
Typ	Proteins
Format	Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against	other
Purity	>98% by SDS-PAGE and HPLC analyses.
Sequence	APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	protein/Z02758-Interleukin-1_beta_IL-1beta_Rhesus_Macaque, IL-1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. The 17 kDa mature rhesus IL1ß shares 96% aa sequence identity with human IL-1 beta.</td></tr><tr><th>M.W.</th><td colspan="7"> Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >98% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rRhIL-1 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL,corresponding to a specific activity of > 1.0×108 units/mg.</td></tr><tr><th>Storage</th><td colspan="7"> This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.</td></tr><tr><th>Formulation</th><td colspan="7"> Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.</td></tr><tr><th>Reconstitution</th><td colspan="7"> We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.</td></tr><tr><th>Physical Appearance</th><td colspan="7"> Sterile Filtered White lyophilized (freeze-dried) powder.</td></tr><tr><th>Usage</th><td colspan="7"> This material is offered by Shanghai PrimeGene for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.</td></tr><tr><th>Sequence</th><td colspan="7"> APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS</td></tr>
Similar products	Interleukin-1
Lieferbar
Specificity	Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL,corresponding to a specific activity of > 1.0x108 units/mg.
Country of Origin	USA
Storage Conditions	This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight	Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
Product Line	Cytokine, Chemokines & Growth Factors
Manufacturer - Specificity	Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL, corresponding to a specific activity of > 1.0x108 units/mg.
Description	IL-1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. The 17 kDa mature rhesus IL1ß shares 96% aa sequence identity with human IL-1 beta.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Formulation	Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Endotoxin Level	Less than 0.2EU/ug of rRhIL-1 as determined by LAL method.
Usage	This material is offered by Shanghai PrimeGene for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Z02758-1-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern