Interleukin-1 beta ( IL-1ß ), Rhesus Macaque

Hersteller GenScript
Kategorie
Typ Proteins
Specific against other
Menge 10ug 
ArtNr Z02758-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Lieferbar
Product Line
Cytokine, Chemokines & Growth Factors
Description
IL-1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. The 17 kDa mature rhesus IL1ß shares 96% aa sequence identity with human IL-1 beta.
M.W.
Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
Purity
>98% by SDS-PAGE and HPLC analyses.
Endotoxin Level
Less than 0.2EU/ug of rRhIL-1 as determined by LAL method.
Specific Activity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL, corresponding to a specific activity of > 1.0x108 units/mg.
Storage
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Formulation
Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Physical Appearance
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage
This material is offered by Shanghai PrimeGene for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.
Sequence
APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS
Menge: 10ug 
Lieferbar: In stock
Listenpreis: 227,73 €
Preis: 227,73 €
lieferbar

Vergleichen

Angebot anfordern

Fragen zum Produkt?

Ihr Ansprechpartner:

Arne Pelz

sales@hoelzel.de

 
Schließen