Vergleich

Interleukin-1 beta (IL-1beta), RhesusMacaque Europäischer Partner

ArtNr Z02758-10
Hersteller GenScript
Menge 10 ug
Quantity options 1 mg 10 ug
Kategorie
Typ Proteins
Format Sterile Filtered White lyophilized (freeze-dried) powder.
Specific against other
Purity >98% by SDS-PAGE and HPLC analyses.
Sequence APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias protein/Z02758-Interleukin-1_beta_IL-1beta_Rhesus_Macaque, IL-1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. The 17 kDa mature rhesus IL1ß shares 96% aa sequence identity with human IL-1 beta.</td></tr><tr><th>M.W.</th><td colspan="7"> Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.</td></tr><tr><th>Purity</th><td colspan="7"> >98% by SDS-PAGE and HPLC analyses.</td></tr><tr><th>Endotoxin Level</th><td colspan="7"> Less than 0.2EU/ug of rRhIL-1 as determined by LAL method.</td></tr><tr><th>Specific Activity</th><td colspan="7"> Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL,corresponding to a specific activity of > 1.0×108 units/mg.</td></tr><tr><th>Storage</th><td colspan="7"> This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.</td></tr><tr><th>Formulation</th><td colspan="7"> Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.</td></tr><tr><th>Reconstitution</th><td colspan="7"> We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.</td></tr><tr><th>Physical Appearance</th><td colspan="7"> Sterile Filtered White lyophilized (freeze-dried) powder.</td></tr><tr><th>Usage</th><td colspan="7"> This material is offered by Shanghai PrimeGene for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.</td></tr><tr><th>Sequence</th><td colspan="7"> APVRSLHCTLRDAQLKSLVMSGPYELKALHLQGQDLEQQVVFSMSFVQGEESNDKIPVALGLKAKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTRGGQDITDFTMQFVSS</td></tr>
Similar products Interleukin-1
Lieferbar
Specificity Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL,corresponding to a specific activity of > 1.0x108 units/mg.
Country of Origin
USA
Storage Conditions
This lyophilized preparation is stable at 2-8 C, but should be kept at -20 C for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 C. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 C to -70 C. Avoid repeated freeze/thaw cycles.
Molecular Weight
Approximately 17.3 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
Product Line
Cytokine, Chemokines & Growth Factors
Manufacturer - Specificity
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of D10.G4.1 mouse helper T cells is typically 3-10pg/mL, corresponding to a specific activity of > 1.0x108 units/mg.
Description
IL-1 beta is a proinflammatory cytokine produced in a variety of cells including monocytes, tissue macrophages, keratinocytes and other epithelial cells. Both IL-1 alpha and IL-1 beta binds to the same receptor and has similar if not identical biological properties. These cytokines have a broad range of activities including, stimulation of thymocyte proliferation, by inducing IL-2 release, B-cell maturation and proliferation, mitogenic FGF-like activity and the ability to stimulate the release of prostaglandin and collagenase from synovial cells. However, whereas IL-1 beta is a secreted cytokine, IL-1 alpha is predominantly a cell-associated cytokine. The 17 kDa mature rhesus IL1ß shares 96% aa sequence identity with human IL-1 beta.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.
Formulation
Lyophilized from a 0.2um filtered concentrated solution in PBS, pH 7.4.
Endotoxin Level
Less than 0.2EU/ug of rRhIL-1 as determined by LAL method.
Usage
This material is offered by Shanghai PrimeGene for research, laboratory or further evaluation purposes. NOT FOR HUMAN USE.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen