Vergleich

CDK6 (cyclin-dependent kinase 6)

ArtNr 18-003-42887
Hersteller GENWAY
Menge 0.1 mg
Kategorie
Typ Antibody
Applikationen WB
Specific against other
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias GWB-2A91D8
Similar products 18-003-42887
Lieferbar
Genway ID:
GWB-2A91D8
Antigen Specificity:
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human CDK6.
Immunogen:
LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Appearance:
Lyophilized powderWB: Antibody
Dilution:
0. 625ug/ml
Handling:
Add 100ul of distilled water to this antibody before use.
ELISA Titre:
1:1562500
Note:
Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. CDK6 is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28. and Schizosaccharomyces pombe cdc2. and are known to be important regulators of cell cycle
Function:
Probably involved in the control of the cell cycle. Interacts with D-type G1 cyclins.
Catalytic Activity:
ATP + a protein = ADP + a phosphoprotein.
Similarity:
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Similarity:
Contains 1 protein kinase domain. Summary: The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28 and Schizosaccharomyces pombe cdc2 and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase as well as CDK4 has been shown to phosphorylate and thus regulate the activity of tumor suppressor protein Rb. Mendrzyk. F. . (2005) J. Clin. Oncol. 23 (34). 8853-8862.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen