Comparison

CDK6 (cyclin-dependent kinase 6)

Item no. 18-003-42887
Manufacturer GENWAY
Amount 0.1 mg
Category
Type Antibody
Applications WB
Specific against other
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias GWB-2A91D8
Similar products 18-003-42887
Available
Genway ID:
GWB-2A91D8
Antigen Specificity:
Polyclonal antibody produced in rabbits immunized with a synthetic peptide corresponding to a region of Human CDK6.
Immunogen:
LLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Appearance:
Lyophilized powderWB: Antibody
Dilution:
0. 625ug/ml
Handling:
Add 100ul of distilled water to this antibody before use.
ELISA Titre:
1:1562500
Note:
Suggested starting concentrations are provided. Optimal dilutions should be determined by end-user. Differences in calculated versus apparent molecular weight may be due to post-translational modifications or protein hydrophobicity. CDK6 is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28. and Schizosaccharomyces pombe cdc2. and are known to be important regulators of cell cycle
Function:
Probably involved in the control of the cell cycle. Interacts with D-type G1 cyclins.
Catalytic Activity:
ATP + a protein = ADP + a phosphoprotein.
Similarity:
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
Similarity:
Contains 1 protein kinase domain. Summary: The protein encoded by this gene is a member of the cyclin-dependent protein kinase (CDK) family. CDK family members are highly similar to the gene products of Saccharomyces cerevisiae cdc28 and Schizosaccharomyces pombe cdc2 and are known to be important regulators of cell cycle progression. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase as well as CDK4 has been shown to phosphorylate and thus regulate the activity of tumor suppressor protein Rb. Mendrzyk. F. . (2005) J. Clin. Oncol. 23 (34). 8853-8862.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close