« Zurück
Startseite /
Oncostatin M Human Recombinant ( 209 a.a. ) ( OSM Human, 209 a.a )

Oncostatin M Human Recombinant ( 209 a.a. ) ( OSM Human, 209 a.a )

ArtNr	PT_41656_1mg
Hersteller	Novateinbio
Menge	1 mg
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins Obesity
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Human (Homo sapiens)
Purity	Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Sequence	AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Oncostatin M Human Recombinant ( 209 a.a. ) ( OSM Human, 209 a.a )
Similar products	Oncostatin M Human Recombinant ( 209 a.a. ) ( OSM Human, 209 a.a )
Lieferbar
Description	Oncostatin-M (209 a.a.) Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 209 amino acids and having a molecular mass of 23.9kDa. The Oncostatin-M (209 a.a.) is purified by proprietary chromatographic techniques.
Storage/Stability	Lyophilized Oncostatin-M (209 a.a.) although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Oncostatin-M (209 a.a.) should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity	Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Form	Oncostatin-M (209 a.a.) was lyophilized from a concentrated (1mg/ml) solution containing 1x PBS pH-7.4.
Protein Background	Oncostatin M is a member of a cytokine family that includes leukemia-inhibitory factor, granulocyte colony-stimulating factor, and interleukin 6. This gene encodes a growth regulator which inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells.
Expression host	Escherichia Coli.
Reagent Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Amino acid sequence	AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFKWGESPNRSRRHSPHQALRKGVRR.
Biological Activity	The ED50 as determined by the dose-dependant stimulation of Human TF-1 cells is
Solubility	It is recommended to reconstitute the lyophilized Oncostatin-M (209 a.a.) in sterile 18M-cm H2O not less than 100ug/ml, which can then be further diluted to other aqueous solutions.
Manufacturers Category	Cancer

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 1 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 15 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern