« Zurück
Startseite /
Recombinant Human B-type Natriuretic Protein

Recombinant Human B-type Natriuretic Protein

ArtNr	cyt-327-2ug
Hersteller	ProSpec
Menge	2ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Cytokines and Growth Factors
Specific against	Human (Homo sapiens)
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Similar products	BNP
Lieferbar
Synonyms	NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide
Introduction	Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function.
Description	B-type Natriuretic Peptide Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton. NPPB is purified by proprietary chromatographic techniques.
Source	Escherichia Coli.
Physical Appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	Natriuretic Peptide Precursor B was lyophilized from 0.4ml PBS buffer containing 20mM phosphate buffer and 0.6mM sodium chloride.
Purity	Greater than 95.0% as determined by(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH.
Storage	Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution NPPB should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

cyt-327-2ug-safety-datasheet.pdf