mLIF

ArtNr	cyt-645-1mg
Hersteller	ProSpec
Menge	1 mg
Quantity options	1 mg 25 ug 3 x 2 ug 5 ug
Kategorie	Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Peptides & Proteins Recombinant Proteins
Typ	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Mouse (Murine, Mus musculus)
Purity	Greater than 95.0% as determined by(a) Analysis by RP-HPLC.<br />(b) Analysis by SDS-PAGE.
Sequence	MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	mLIF,CDF,HILDA,D-FACTOR,Differentiation- stimulating factor,Melanoma-derived LPL inhibitor,MLPLI,Emfilermin,Leukemia inhibitory factor,LIF,DIA
Similar products	mLIF
Lieferbar
Manufacturer - Category	CYTOKINES AND GROWTH FACTORS
Storage Conditions	Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Description	Recombinant Mouse Leukemia Inhibitory Factor
Formulation	Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.
Introduction	Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Biological Activity	Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be 0.01 ng/ml, corresponding to a specific activity of 100, 000, 000 IU/mg. A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.
Manufacturer - Format	Sterile Filtered White lyophilized (freeze-dried) powder.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

cyt-645-1mg-safety-datasheet.pdf