Comparison

mLIF European Partner

Item no. cyt-645-1mg
Manufacturer ProSpec
Amount 1 mg
Quantity options 1 mg 25 ug 3 x 2 ug 5 ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Purity Greater than 95.0% as determined by(a) Analysis by RP-HPLC.<br />(b) Analysis by SDS-PAGE.
Sequence MSPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFP NNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNP TAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQR KKLGCQLLGTYKQVISVVVQAF.
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias mLIF,CDF,HILDA,D-FACTOR,Differentiation- stimulating factor,Melanoma-derived LPL inhibitor,MLPLI,Emfilermin,Leukemia inhibitory factor,LIF,DIA
Similar products mLIF
Available
Manufacturer - Category
CYTOKINES AND GROWTH FACTORS
Storage Conditions
Lyophilized Leukemia Inhibitory Factor (LIF) although stable at room temperature for 3 weeks, should be stored desiccated below -18C. Upon reconstitution Leukemia Inhibitory Factor (LIF) should be stored at 4C between 2-7 days and for future use below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Description
Recombinant Mouse Leukemia Inhibitory Factor
Formulation
Leukemia Inhibitory Factor (LIF) was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM Phosphate buffer pH-7.4 and 0.02% Tween-20.
Introduction
Leukemia Inhibitory Factor also called LIF is a lymphoid factor that promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Leukemia Inhibitory Factor has several functions such as cholinergic neuron differentiation, control of stem cell pluripotency, bone & fat metabolism, mitogenesis of factor dependent cell lines & promotion of megakaryocyte production in vivo. Human and mouse LIF exhibit a 78% identity in its amino acid sequence.
Usage
ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Biological Activity
Activity of murine LIF was determined by the M1 cell differentiation assay which was found to be 0.01 ng/ml, corresponding to a specific activity of 100, 000, 000 IU/mg.
A standard of 50 Units is defined as the concentration of mouse LIF in 1.0 mL of tissue culture medium that induces the differentiation of 50% of M1 colonies.
Manufacturer - Format
Sterile Filtered White lyophilized (freeze-dried) powder.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close